PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI11G11920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 320aa    MW: 34636.7 Da    PI: 8.0517
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI11G11920.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP56.86.1e-1839781251
                     TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEE CS
              SBP 12 seakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhe 51
                     s++++yhrrhkvCe+h+k+pvv+v+g+eqrfCqqCsr h+
  OMERI11G11920.1 39 SRCRDYHRRHKVCEAHAKTPVVVVAGQEQRFCQQCSRSHT 78
                     689**********************************996 PP

2SBP47.54.7e-15831372878
                      HT-S-EEETTEEEEE-TT....TSSEEETTT--SS--S-STTTT-------S--- CS
              SBP  28 skapvvlvsgleqrfCqq....CsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +ka+vv++ + ++r          rfh+l efD++k+sCr+rL++hn+rrrk+q+
  OMERI11G11920.1  83 TKATVVIMCEDMKRIDHEvyaaNQRFHNLAEFDDGKKSCRKRLDGHNRRRRKPQH 137
                      677777776666665443111157****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114119.75126135IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.75E-163979IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.102.2E-203974IPR004333Transcription factor, SBP-box
PfamPF031104.0E-133978IPR004333Transcription factor, SBP-box
PfamPF031101.0E-7106134IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.22E-11106139IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.102.2E-20107122IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MEWAAAATKA ASWGMAVAAA AADDAGPTML SFAGPSSSSR CRDYHRRHKV CEAHAKTPVV  60
VVAGQEQRFC QQCSRSHTEQ TQTKATVVIM CEDMKRIDHE VYAANQRFHN LAEFDDGKKS  120
CRKRLDGHNR RRRKPQHDAL NPRSFLPYHQ ANQFSVYPQT FPIADQSADA LMRPLDRHPP  180
FSISFSGTFR EPKQFPFLQD GGSGLGAARH DLLRPFSSPE DGANITTTRS ACNGVPHGLD  240
PECALSLLSS SLHPSPAAGI SSATAPPQFA PSSFSRIAAS SQAVTTAFAS DGGSVAGDHV  300
LVPAVTYEDP SQAMPFSWQV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117134KKSCRKRLDGHNRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1336080.0AC133608.4 Oryza sativa Japonica Group chromosome 11 clone OSJNBb0085G12, complete sequence.
GenBankAC1355690.0AC135569.6 Oryza sativa Japonica Group chromosome 11 clone OSJNBb0018F17, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617950.11e-170PREDICTED: putative squamosa promoter-binding-like protein 19
SwissprotQ2R3Y11e-172SPL19_ORYSJ; Putative squamosa promoter-binding-like protein 19
TrEMBLA0A0E0F5Z90.0A0A0E0F5Z9_9ORYZ; Uncharacterized protein
STRINGORGLA11G0121600.11e-170(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129612532
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-28SBP family protein